PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC414_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 948aa    MW: 104090 Da    PI: 6.2783
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC414_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.89.7e-24127228199
                EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++i+r++++r++lt+GW+ Fv+ ++L +gD+v+F +  + +++l++
  RrC414_p2 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIFRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFVR--DGKGQLLL 223
                99*****************************98888885.9************************************************5..468889** PP

                EEE-S CS
         B3  95 kvfrk 99 
                +++r+
  RrC414_p2 224 GIRRA 228
                **997 PP

2Auxin_resp117.11.5e-38253335183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g++dldpvrW+nS+Wr+L+
   RrC414_p2 253 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGITDLDPVRWKNSQWRNLQ 335
                 799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.83E-42117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-41121242IPR015300DNA-binding pseudobarrel domain
CDDcd100173.80E-21126227No hitNo description
PROSITE profilePS5086312.421127229IPR003340B3 DNA binding domain
PfamPF023629.0E-22127228IPR003340B3 DNA binding domain
SMARTSM010192.3E-23127229IPR003340B3 DNA binding domain
PfamPF065071.3E-33253335IPR010525Auxin response factor
PfamPF023092.4E-9819907IPR033389AUX/IAA domain
PROSITE profilePS5174526.174821914IPR000270PB1 domain
SuperFamilySSF542777.85E-9834899No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 948 aa     Download sequence    Send to blast
MKAPSSNGVS PNPMEGERRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLQ NVTLNADPET EEVYAQMTLQ PVNKYDREAL LASDMGLKLN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIFRGQPKRH LLTTGWSVFV STKRLLAGDS VLFVRDGKGQ LLLGIRRANR QQPALSSSVI  240
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI  300
FETEECGVRR YMGTVTGITD LDPVRWKNSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPRFAGQPGM PDDGTDMESA LKRAMPWLDN GLEMKDPSST IFPGLSLVQW  420
MSMQQQNGQV PGAAAQPGFF PSMLSPAAAL HNNLGGADDP SNKSSSNLMS KPPQDTQFSR  480
QMEQQQPSGL VQGHNQQTLV QQKTQQSQVQ QRFQQSLLEQ PHLQFQLLQR LQQQQQQQQQ  540
QQFLSPGSSS LQSQLLHQQL QSQQLQQLPS ISQGQQFPSS CTNTGLPSLQ PPQMLVSRPQ  600
DKHNPPVGGG AKAYSGITDG GDAPSSSTSP STNNCQISSS TFLNRSQSGP AILIPDPAVD  660
VSASLVQDLY SKSDMRLKHE LVSQQKPKAS LTDHQQLEAS ASGTSYGLDG GENSRQQNFL  720
SPNFGLDGDS RNSLFGGANV ENGFVPDTLL SRGYDSQKDL QNMLSNYGGV TNDIGTEMST  780
SAVRTQSFGI PNVPAISNDL AVNDAGVLGG GLWPTQAQRM RTYTKVQKRG SVGRSIDVNR  840
YRGYDELRHD LARMFGIEGQ LEDPLTSDWK LVYVDHENDI LLVGDDPWEE FVNCVQSIKI  900
LSSAEVQQMS LDGNFAGLPA TNQACSGGDN GNGWRGQYDD NSANSFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1652135651388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794690.0JN979469.1 Brassica rapa subsp. pekinensis auxin response factor 7-1 (ARF7-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_851047.10.0auxin-regulated transcriptional activator NPH4
SwissprotP930220.0ARFG_ARATH; Auxin response factor 7
TrEMBLA0A078FQ450.0A0A078FQ45_BRANA; Auxin response factor
STRINGAT5G20730.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein